Thymosin Alpha-1 vs Thymosin Beta-4
Reviewed by the BestHealingPeptides Editorial Team ·
Thymosin Alpha-1 and Thymosin Beta-4 share the historical 'thymosin' name because both were originally isolated from the same bovine thymic Fraction 5 preparation by Allan Goldstein's laboratory in the 1970s. Despite the naming, they are structurally, mechanistically, and pharmacologically distinct compounds addressing entirely different biological processes. Thymosin Alpha-1 is an immune-modulator; Thymosin Beta-4 is an actin-binding tissue-repair peptide. This comparison clarifies the differentiation that the confusing shared naming can obscure.
Thymosin Alpha-1
A 28-amino-acid N-terminally acetylated peptide originally isolated from bovine thymus by Allan Goldstein's laboratory in 1977, subsequently characterised as an endogenous immune-modulating peptide produced by thymic epithelial cells. Marketed as Zadaxin (thymalfasin) with regulatory approval in 35+ countries — including in Europe (Italy) but NOT in the UK or US — for chronic hepatitis B and C, as an adjuvant in hepatocellular carcinoma, and in HIV/AIDS contexts. Distinct from Thymosin Beta-4 in both sequence and mechanism.
Thymosin Beta-4
A 43-amino-acid actin-sequestering peptide expressed in nearly all human cells. Distinct from the shorter TB-500 fragment; investigated in cardiac repair, corneal healing, neural regeneration, and dermal regeneration.
| Aspect | Thymosin Alpha-1 | Thymosin Beta-4 |
|---|---|---|
| Discovery | Goldstein lab, bovine thymus Fraction 5, 1977 | Goldstein lab, bovine thymus Fraction 5, 1977 |
| Sequence | 28 amino acids, N-terminally acetylated | 43 amino acids, no acetylation |
| Molecular weight | ~3,108 Da | ~4,960 Da |
| Principal mechanism | TLR2/TLR9 immune-modulatory | G-actin sequestration (LKKTETQ motif) |
| Biological function | T-cell maturation, immune modulation | Cell migration, tissue repair, angiogenesis |
| Clinical development | Zadaxin licensed in ~35 countries (not UK) | Pre-clinical / early clinical; not licensed anywhere |
| Principal research applications | Chronic hepatitis, HCC adjuvant, HIV, immune modulation | Corneal wound healing, cardiac repair, tendon repair |
| Research-chemical variant naming | Zadaxin, thymalfasin (both = full Tα1) | TB-500 (fragment, not equivalent to Tβ4) |
Historical shared naming — Fraction 5 discovery
Both peptides were originally isolated from bovine thymic Fraction 5 preparation by Allan Goldstein and colleagues at the George Washington University in 1977 (Goldstein et al., PNAS 1977 for both). The Fraction 5 preparation was a partially purified thymic extract that contained multiple bioactive components; Goldstein's laboratory characterised the α (first electrophoretic migrating fraction) and β (second migrating fraction) components as thymosin alpha-1 and thymosin beta-4 respectively. The 'thymosin' name reflected the thymic-tissue origin rather than any specific biological function shared between the two peptides. The naming has persisted despite the two peptides being mechanistically unrelated, which continues to create confusion in the peptide-research and research-chemical-community contexts.
Structural differences
Thymosin Alpha-1 (Tα1) is a 28-amino-acid N-terminally acetylated peptide (Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN) with molecular weight approximately 3,108 Da. The N-terminal acetylation is characteristic and functionally important — the non-acetylated form has reduced activity. Thymosin Beta-4 (Tβ4) is a 43-amino-acid peptide (SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES) without N-terminal acetylation, with molecular weight approximately 4,960 Da. The central LKKTETQ heptapeptide motif is the actin-binding pharmacophore. The two peptides share no meaningful sequence similarity beyond both being polar and unstructured in aqueous solution. The size difference (28 vs 43 amino acids) is also notable pharmacologically — Tα1 is closer to the small-peptide research space; Tβ4 is closer to the small-protein space.
Mechanistic differences
Thymosin Alpha-1 is an immune-modulator engaging Toll-like receptor 2 (TLR2) and TLR9 on dendritic cells and macrophages, driving Th1-polarised T-cell responses through IL-12/STAT4 signalling and enhancing antigen presentation and T-cell maturation. The mechanism operates in the immune system through cell-surface receptor engagement. Thymosin Beta-4 is an actin-binding tissue-repair peptide that sequesters G-actin monomers (through the LKKTETQ motif), maintains the cytoplasmic G-actin pool essential for cell migration, and drives cellular migration, angiogenesis, and tissue repair. The mechanism operates in the cytoplasm of migrating cells through direct protein-protein binding rather than receptor engagement. The two mechanisms address entirely different biological processes and cellular substrates.
Pharmacological and clinical use differences
Thymosin Alpha-1 is developed clinically for immune-dysfunction indications: chronic hepatitis B and C, HCC adjuvant, HIV, cancer chemotherapy adjuvant, and vaccination adjuvant. It is registered as Zadaxin (thymalfasin) in approximately 35 countries — including Italy in Europe — but not in the UK, US, or other major Western jurisdictions. Thymosin Beta-4 is developed pre-clinically and in early clinical exploration for tissue-repair indications: corneal wound healing, cardiac repair post-infarct, dermal wound healing, and tendon and skeletal-muscle repair. It has not achieved marketing authorisation in any jurisdiction; the smaller commercial variant TB-500 (which the research-chemical market often supplies) is a fragment rather than the full-length molecule. The two peptides therefore occupy entirely different clinical and research-application spaces despite the shared naming heritage.
TB-500 versus Thymosin Beta-4 — additional naming confusion
A second layer of naming confusion affects Thymosin Beta-4. The research-chemical market widely supplies 'TB-500' as a research peptide, but TB-500 is a synthetic fragment of Thymosin Beta-4 (typically the LKKTETQ-containing region) rather than the full 43-amino-acid molecule. The fragment retains actin-binding activity but the identity supplied under the TB-500 label is not always defined and vendor-to-vendor variability is substantial. Research using 'TB-500' should verify the molecular identity by mass spectrometry. See the tb-500-vs-thymosin-beta-4 comparison for detailed discussion. This TB-500/Tβ4 fragment-vs-full-length distinction adds a second layer of confusion beyond the shared 'thymosin' name of Tα1 and Tβ4.
Verdict
Thymosin Alpha-1 and Thymosin Beta-4 are entirely distinct compounds despite the shared historical name. Tα1 is an immune-modulator (Zadaxin, registered in ~35 countries) targeting T-cell function through TLR2/TLR9 receptor engagement. Tβ4 is an actin-binding tissue-repair peptide (not licensed anywhere) targeting cell migration and tissue repair through G-actin sequestration. Choose the compound based on the research or clinical application — they are not substitutes for each other, and the shared name should not obscure the fundamental mechanistic differences. The additional TB-500 fragment nomenclature further complicates the Tβ4 space and requires attention to molecular-identity verification in research contexts.
Where to source research peptides for laboratory research
The following UK-based suppliers stock research-grade, lyophilised peptides for in-vitro and pre-clinical work. Purity and provenance vary; always request a Certificate of Analysis (CoA) and confirm cold-chain storage on arrival. None of the products linked below are approved for human use.
- PeptideAuthority.co.uk
UK-based research peptide supplier with batch certificates of analysis and >99% purity testing.
- PeptideBarn.co.uk
Wide catalogue of research-grade lyophilised peptides shipped from the UK, including bulk vials.