Skip to content
BHP

Antimicrobial research peptides: cationic membrane disruption

Reviewed by the BestHealingPeptides Editorial Team ·

Antimicrobial research peptides are typically cationic amphipathic helices that insert into anionic microbial membranes, disrupting bilayer integrity while modulating host innate-immune responses.

LL-37 forms complexes with extracellular self-DNA in psoriatic skin, enabling these complexes to activate TLR9 in plasmacytoid dendritic cells and trigger IFN-α release — demonstrating that the same cationic properties responsible for antimicrobial membrane disruption can, when dysregulated, convert host-derived nucleic acids into potent autoinflammatory triggers (Lande et al., Nature, 2007).

Notable finding

Detailed explanation

Antimicrobial peptides (AMPs) represent an evolutionarily ancient component of the innate immune system, deployed at epithelial surfaces and in phagocytic cells as a first line of defence against microbial invasion. Their primary mechanism of action exploits a fundamental difference between prokaryotic and eukaryotic membranes: bacterial outer leaflets are enriched in anionic phospholipids — phosphatidylglycerol, cardiolipin, and lipopolysaccharide (LPS) in Gram-negative organisms — while mammalian plasma membranes present predominantly zwitterionic phospholipids (phosphatidylcholine, sphingomyelin) with cholesterol providing stabilising rigidity. Cationic AMPs carry a net positive charge (+2 to +9) at physiological pH and are preferentially attracted to anionic microbial surfaces by electrostatic interactions, achieving selective docking without equivalent affinity for host cell membranes. Following electrostatic docking, amphipathic AMPs insert their hydrophobic face into the lipid bilayer core. Membrane disruption models include the carpet mechanism (lateral coating of the outer leaflet until a threshold coverage causes membrane solubilisation), toroidal-pore formation (peptide–lipid complexes that create transient water-filled channels spanning both leaflets), and the barrel-stave model (peptide bundles forming a cylindrical pore). The net result across these models is membrane depolarisation, ATP and cytoplasmic content leakage, and rapid bacterial death at concentrations in the low-micromolar range — below those required for significant mammalian cytotoxicity in most AMPs. Beyond direct membrane killing, some AMPs also enter bacterial cells and disrupt nucleic acid, protein synthesis, or cell-wall synthesis machinery. Host innate-immune modulation is a second major dimension of AMP biology. Many AMPs, including LL-37, function as alarmins that recruit and activate immune cells, modulate Toll-like receptor (TLR) signalling, and promote wound healing — activities that extend well beyond microbial killing. Standard pre-clinical assays for antimicrobial mechanism include minimum inhibitory concentration (MIC) determination by broth microdilution against reference organisms (MRSA, Pseudomonas aeruginosa, Candida albicans), time-kill kinetics, membrane permeability assessment using fluorescent dyes (SYTOX Green, propidium iodide), and biofilm disruption assays. Electron microscopy (scanning and transmission) provides direct visualisation of membrane disruption morphology. LL-37 is the only human cathelicidin antimicrobial peptide, derived by serine-protease (kallikrein 5, proteinase 3) cleavage of the 18 kDa precursor hCAP-18. Its 37-residue sequence ([LL-37, 37 aa]) adopts a disordered solution conformation that rapidly refolds into an amphipathic alpha-helix at lipid membrane surfaces, positioning lysine and arginine residues to face the anionic microbial bilayer. LL-37 produces MICs of 2–8 µg/mL against clinical MRSA isolates and 4–16 µg/mL against P. aeruginosa in standard broth assays, with enhanced efficacy against established biofilms compared with conventional antibiotics. Critically, LL-37 also engages formyl peptide receptor 2 (FPR2/ALX) on neutrophils and macrophages to drive chemotaxis and degranulation, and transactivates EGFR on keratinocytes through ADAM-10/17-mediated HB-EGF shedding — linking the direct antimicrobial mechanism to the wound-healing and angiogenic activities described in the angiogenesis hub. The double-edged nature of LL-37 is exemplified by its role in psoriasis, where complexes with self-DNA activate plasmacytoid dendritic cells via TLR9, triggering IFN-α release and sustaining autoinflammatory disease. A critical practical consideration in LL-37 research is the peptide's strong adsorption to standard polystyrene and polypropylene labware due to its cationic character; low-binding vessels and carrier protein (BSA at 0.01–0.1%) are required to maintain accurate working concentrations. Additionally, serum proteins — particularly alpha-2-macroglobulin, LDL, and heparan sulphate proteoglycans — bind LL-37 avidly, substantially reducing its free effective concentration in serum-containing media. MIC assays for this reason are typically conducted in serum-free conditions.

Peptides operating via this mechanism

Where to source research peptides for laboratory research

The following UK-based suppliers stock research-grade, lyophilised peptides for in-vitro and pre-clinical work. Purity and provenance vary; always request a Certificate of Analysis (CoA) and confirm cold-chain storage on arrival. None of the products linked below are approved for human use.

  • PeptideAuthority.co.uk

    UK-based research peptide supplier with batch certificates of analysis and >99% purity testing.

  • PeptideBarn.co.uk

    Wide catalogue of research-grade lyophilised peptides shipped from the UK, including bulk vials.