LL-37
Cathelicidin LL-37 · hCAP-18 fragment · Human cathelicidin antimicrobial peptide
Reviewed by the BestHealingPeptides Editorial Team ·
The only human cathelicidin antimicrobial peptide — a 37-residue cationic amphipathic helix studied for direct antimicrobial action, wound healing, angiogenesis, and dual-edged modulation of host innate immune responses.
Mechanism of action
LL-37 is the sole human representative of the cathelicidin family of antimicrobial peptides. The mature 37-amino-acid peptide ([LL-37, 37 aa]) is cleaved from its 18 kDa precursor hCAP-18 by serine proteases including kallikrein 5 and 7 at skin surfaces, and by proteinase 3 in neutrophils. The name 'LL-37' derives from the two N-terminal leucines and the 37-residue length. In solution, LL-37 adopts a predominantly disordered conformation but rapidly forms an amphipathic alpha-helix in the presence of lipid membranes or at physiological ionic strengths at wound surfaces. This conformational shift is central to its antimicrobial mechanism: the helical face positions positively charged lysine and arginine residues toward anionic microbial membrane lipids (phosphatidylglycerol, lipopolysaccharide headgroups), enabling electrostatic docking followed by membrane insertion and disruption. Models of membrane destabilisation include the carpet mechanism (parallel insertion of multiple peptides leading to membrane solubilisation) and toroidal-pore formation. The net result is loss of microbial membrane integrity, ATP leakage, and rapid bacterial death at concentrations in the low-micromolar range. Beyond direct killing, LL-37 functions as a host signalling molecule of considerable potency. It is a ligand for formyl peptide receptor 2 (FPR2/ALX) on neutrophils, monocytes, and macrophages, triggering chemotaxis, degranulation, and cytokine release. On keratinocytes, LL-37 transactivates the epidermal growth factor receptor (EGFR) through ADAM-10/17-mediated shedding of HB-EGF, driving proliferation and migration essential for re-epithelialisation. In endothelial cells, FPRL1 engagement and intracellular signalling downstream promote tube formation and angiogenesis, as characterised by Koczulla and colleagues (J Clin Invest 2003). The dual-edged nature of LL-37 becomes apparent in skin disease. Under normal conditions, LL-37 concentrations at epithelial surfaces are low and tightly regulated by protease-mediated degradation. In psoriasis, however, LL-37 released in excess from activated keratinocytes and neutrophils forms complexes with self-DNA and self-RNA. These complexes are internalised by plasmacytoid dendritic cells via endosomal Toll-like receptor 7 and 9, triggering massive IFN-α release that sustains the psoriatic inflammatory loop — a mechanism elegantly characterised by Lande, Gilliet, and colleagues (Nature 2007). In rosacea, LL-37 produced by serine-protease-activated skin is implicated in driving the angiogenic and inflammatory components of the condition. Thus, LL-37 is both an essential defence molecule and a potential pathogenic driver when dysregulated.
LL-37 forms complexes with extracellular self-DNA in psoriatic skin, enabling these complexes to penetrate plasmacytoid dendritic cells and activate TLR9, triggering massive IFN-α release that sustains the psoriatic autoinflammatory cycle (Lande et al., Nature 2007). This mechanistic discovery transformed understanding of LL-37 from a simple host-defence antibiotic to a pivotal link between keratinocyte-derived antimicrobial peptides and autoinflammatory disease.
— Notable finding
Research history
The cathelicidin gene family was defined in the early 1990s across multiple vertebrate species. The human cathelicidin gene CAMP encodes the precursor protein hCAP-18, which was first identified in human neutrophils by Cowland, Johnsen, and Borregaard in 1995. The mature LL-37 peptide derived from hCAP-18 cleavage was characterised and its antimicrobial activity described by Agerberth and colleagues in 1995, and separately by Gudmundsson and colleagues in 1996. Unlike many species that carry multiple cathelicidin genes, humans carry only one — CAMP — making LL-37 the single human cathelicidin. This evolutionary bottleneck has driven considerable interest in understanding how one peptide can serve such diverse functions across skin immunity, mucosal defence, wound repair, and inflammatory regulation. Seminal work in the early 2000s expanded the LL-37 pharmacology considerably. Heilborn and colleagues (J Invest Dermatol 2003) demonstrated that LL-37 expression was markedly elevated at the wound edge and correlated with re-epithelialisation rate in chronic skin ulcers, and that topical LL-37 accelerated wound closure in animal models. Koczulla and colleagues (J Clin Invest 2003) characterised the pro-angiogenic activity of LL-37 using endothelial tube-formation assays and chick chorioallantoic membrane models, establishing a mechanism beyond simple antimicrobial action. The psoriasis connection emerged from Lande and Gilliet's groups and was published in Nature (2007), profoundly changing understanding of LL-37 from a simple antimicrobial to a central orchestrator of autoinflammatory disease when produced in excess. Subsequent work has implicated LL-37–DNA complexes in lupus and other interferonopathies. In respiratory medicine, LL-37 has been investigated in the context of COVID-19 and vitamin D, since vitamin D signalling via VDR upregulates CAMP gene expression. This link has driven research into whether vitamin D supplementation could bolster LL-37-mediated innate immunity against respiratory pathogens.
Reconstitution & storage
Summarised studies
| Year | Model | Outcome | Citation | Source |
|---|---|---|---|---|
| 2003 | Chronic venous leg ulcer biopsies (human); murine full-thickness wound model (topical LL-37 application) | LL-37 expression at the wound margin correlated positively with re-epithelialisation rate in human ulcer biopsies. Topical LL-37 application to murine wounds accelerated epithelial closure and increased keratinocyte proliferation compared with vehicle controls. | Heilborn J.D. et al., J Invest Dermatol | PMID 12787135 |
| 2003 | Human umbilical vein endothelial cells (HUVECs); chick chorioallantoic membrane (CAM) angiogenesis assay | LL-37 induced HUVEC proliferation and tube formation at concentrations of 0.5–5 µg/mL. CAM assay confirmed in vivo pro-angiogenic effect. FPRL1 (FPR2) receptor engagement was identified as the initiating signal. | Koczulla R. et al., J Clin Invest | PMID 12704389 |
| 2007 | Human plasmacytoid dendritic cells (pDCs) from psoriatic lesions; in vitro TLR7/9 activation assays | LL-37 bound extracellular self-DNA from psoriatic skin, forming aggregated complexes that enabled endosomal entry into pDCs, triggering TLR9-dependent IFN-α production. Neutralisation of LL-37 abrogated IFN-α release, identifying LL-37 as the initiating trigger of the psoriatic autoinflammatory loop. | Lande R. et al., Nature | PMID 17972569 |
| 2007 | Human rosacea skin biopsies; murine rosacea-like model with kallikrein-5-overexpressing mice | Rosacea skin showed elevated LL-37 and kallikrein 5, the serine protease responsible for LL-37 cleavage from hCAP-18. Kallikrein-5-overexpressing mice developed rosacea-like inflammation that was abolished by LL-37 neutralisation. Abnormal LL-37 processing produced a distinct inflammatory peptide profile. | Yamasaki K. et al., Nat Med | PMID 17660842 |
| 2010 | Minimum inhibitory concentration (MIC) assays; biofilm models; murine skin infection model | LL-37 produced MICs of 2–8 µg/mL against clinical MRSA isolates and 4–16 µg/mL against P. aeruginosa, with enhanced activity in biofilm disruption compared with conventional antibiotics. Murine skin-infection model demonstrated reduced bacterial burden following topical LL-37. | Overhage J. et al., Antimicrob Agents Chemother | — |
| 2009 | Human alveolar macrophages and respiratory epithelial cells; vitamin D receptor (VDR) reporter assays | 1,25-dihydroxyvitamin D3 strongly induced CAMP gene transcription via a VDR-response element in the promoter, increasing LL-37 protein in macrophages and epithelial cells. Vitamin D supplementation increased LL-37 expression in macrophages from vitamin-D-deficient donors and enhanced killing of Mycobacterium tuberculosis. | Liu P.T. et al., Science | PMID 16497895 |
LL-37 accelerates re-epithelialisation in human chronic wounds
Heilborn J.D. et al., J Invest Dermatol · 2003 · PMID 12787135
Established LL-37 as a clinically relevant wound-healing effector by combining correlational human biopsy data with mechanistic murine wound experiments, showing that the peptide is not merely antimicrobial but actively promotes keratinocyte proliferation and migration.
PubMedPro-angiogenic activity of LL-37 in endothelial cells
Koczulla R. et al., J Clin Invest · 2003 · PMID 12704389
Landmark paper identifying angiogenesis as a major non-antimicrobial function of LL-37, and characterising FPRL1 as the responsible receptor — expanding understanding of LL-37 from a membrane-disrupting antibiotic to a multifunctional tissue-repair mediator.
PubMedLL-37–DNA complexes activate plasmacytoid dendritic cells in psoriasis
Lande R. et al., Nature · 2007 · PMID 17972569
Mechanistic breakthrough demonstrating that LL-37 converts self-DNA into a potent innate immune activator in psoriatic skin, directly linking overexpression of a normally protective antimicrobial peptide to autoinflammatory disease — the definitive characterisation of LL-37's double-edged immunological role.
PubMedLL-37 contributes to rosacea inflammatory response
Yamasaki K. et al., Nat Med · 2007 · PMID 17660842
Established the mechanistic basis for LL-37's role in rosacea pathogenesis, showing that aberrant kallikrein-5-mediated processing of hCAP-18 generates LL-37 fragments that drive angiogenesis, neutrophil infiltration, and the characteristic inflammatory lesions of rosacea.
PubMedAntimicrobial activity of LL-37 against MRSA and Pseudomonas aeruginosa
Overhage J. et al., Antimicrob Agents Chemother · 2010
Quantitative characterisation of LL-37's antimicrobial activity against clinically relevant resistant organisms, and demonstration that the peptide disrupts established biofilms, supporting its relevance to chronic wound and device-associated infection research.
Vitamin D upregulates LL-37 production in respiratory epithelium
Liu P.T. et al., Science · 2009 · PMID 16497895
Identified the mechanistic link between vitamin D status and innate antimicrobial defence via LL-37 upregulation, providing a molecular rationale for the epidemiological association between vitamin D deficiency and susceptibility to respiratory infection.
PubMedSafety profile
LL-37 presents a substantially more complex safety profile than most research peptides, primarily because it is a potent biological mediator with established pathogenic roles at elevated concentrations. At the concentrations present in normal human tissues (estimated 1–5 µg/mL in sweat and wound fluid, lower in plasma), LL-37 is well tolerated and is essential for mucosal and cutaneous defence. The therapeutic index of exogenously administered LL-37 is less well characterised. In animal studies, subcutaneous and topical delivery has generally been tolerated, but systemic intravenous administration at high doses has been associated with cardiovascular effects attributable to the peptide's membrane-active properties on mammalian cell membranes — selectivity for prokaryotic versus eukaryotic membranes is not absolute. The inflammatory amplification capacity of LL-37 is the most practically relevant safety consideration in research contexts. In individuals with predisposing conditions (atopic diathesis, psoriasis, rosacea), supraphysiological LL-37 concentrations — even topically applied — could theoretically exacerbate skin disease by activating the TLR7/9-pDC-IFN-α axis. This has not been characterised systematically in controlled research, but the mechanistic basis is well established. A significant practical problem in LL-37 research is adsorption to plastic surfaces. LL-37 is highly cationic and binds avidly to standard polystyrene and polypropylene labware, leading to substantial and unpredictable losses of effective concentration. Studies that do not account for adsorption losses may report effective concentrations that are considerably lower than nominal. Low-binding tubes and plates, and addition of carrier protein (BSA at 0.1–0.01%) in non-cellular assays, are recommended in the research literature. Serum and tissue proteins bind LL-37 extensively. Alpha-2-macroglobulin, LDL, and glycosaminoglycans (notably heparan sulphate) all sequester LL-37 and reduce its free concentration, further complicating dose interpretation in cell-culture media containing foetal bovine serum. This protein-binding effect also means plasma half-life measured in vivo may not reflect biologically active concentration at tissue sites.
Reported contraindications & cautions
- Not characterised for human use; all safety data are pre-clinical.
- Theoretical risk of exacerbating autoinflammatory skin conditions (psoriasis, rosacea, atopic dermatitis) at supraphysiological concentrations.
- Unknown safety in pregnancy and lactation.
- Cardiovascular effects reported at high intravenous doses in animal studies due to non-selective membrane activity.
- Potential for pro-inflammatory amplification in subjects with active autoimmune disease, based on mechanistic pDC-activation data.
Known formulation interactions
- Glycosaminoglycans (heparan sulphate, dermatan sulphate): bind LL-37 with high affinity and reduce free peptide concentration; relevant in extracellular-matrix-containing assays.
- Serum lipoproteins (LDL, HDL): sequester LL-37, reducing effective antimicrobial concentration in serum-containing media.
- Alpha-2-macroglobulin: high-affinity binding reduces LL-37 biological activity in plasma.
- Protease inhibitors: serpins and SLPI at wound surfaces protect LL-37 from inactivation and may prolong its half-life; coadministration with serine protease inhibitors in research alters effective LL-37 concentration.
- No established pharmacokinetic drug–drug interactions in humans.
UK regulatory status
LL-37 is not authorised as a medicine by the UK Medicines and Healthcare products Regulatory Agency (MHRA). There is no marketing-authorisation application for LL-37 on record in the UK or European Medicines Agency databases as a standalone pharmaceutical. LL-37 is not included on the World Anti-Doping Agency (WADA) Prohibited List as of the 2025 iteration. It does not have anabolic, lipolytic, or growth-promoting properties that would place it within the classes of peptides most commonly targeted by WADA (S0, S1, S2). Athletes and researchers in competitive-sport contexts should nevertheless verify the current list, as WADA periodically updates categories. In the United Kingdom, possession of LL-37 for genuine in-vitro laboratory research is unrestricted. It is not a scheduled substance under the Misuse of Drugs Act 1971. Supply for human therapeutic administration or promotion of such use would require MHRA authorisation. No enforcement actions against LL-37 specifically have been publicly reported by the MHRA.
Frequently asked questions
Is LL-37 the same as cathelicidin?
Why is LL-37 considered a 'double-edged' peptide?
How is LL-37 stored and handled in research laboratories?
Does LL-37 have activity against viruses as well as bacteria?
Does exogenous LL-37 worsen psoriasis or rosacea in research models?
What is the relationship between vitamin D and LL-37 production?
Is LL-37 regulated or banned by WADA?
Can LL-37 be used as an antibiotic in research wound models?
References
- LL-37 accelerates re-epithelialisation in human chronic wounds. Heilborn J.D. et al., J Invest Dermatol (2003). PMID 12787135
- Pro-angiogenic activity of LL-37 in endothelial cells. Koczulla R. et al., J Clin Invest (2003). PMID 12704389
- LL-37–DNA complexes activate plasmacytoid dendritic cells in psoriasis. Lande R. et al., Nature (2007). PMID 17972569
- LL-37 contributes to rosacea inflammatory response. Yamasaki K. et al., Nat Med (2007). PMID 17660842
- Antimicrobial activity of LL-37 against MRSA and Pseudomonas aeruginosa. Overhage J. et al., Antimicrob Agents Chemother (2010).
- Vitamin D upregulates LL-37 production in respiratory epithelium. Liu P.T. et al., Science (2009). PMID 16497895
- UniProt entry: human cathelicidin antimicrobial peptide (CAMP) precursor
- MHRA — UK medicines regulator
- PubMed search: LL-37 cathelicidin
Where to source LL-37 for laboratory research
The following UK-based suppliers stock research-grade, lyophilised peptides for in-vitro and pre-clinical work. Purity and provenance vary; always request a Certificate of Analysis (CoA) and confirm cold-chain storage on arrival. None of the products linked below are approved for human use.
- PeptideAuthority.co.uk
UK-based research peptide supplier with batch certificates of analysis and >99% purity testing.
- PeptideBarn.co.uk
Wide catalogue of research-grade lyophilised peptides shipped from the UK, including bulk vials.
Appears in research stacks
Skin & Wound Healing Research Stack
Address dermal collagen synthesis, angiogenesis, and antimicrobial defence in pre-clinical wound-healing models.
Athletic Injury Recovery Research Stack
Cover the heterogeneous tissue injury profile seen in athletic injury models — combining tendon, muscle, dermal, and antimicrobial peptide research candidates in one combined research arm.
Anti-Aging Skin Research Stack
Explore combined effects on dermal collagen and elastin synthesis, cellular ageing markers, and antimicrobial barrier integrity in skin-research models.
Mucosal Immune Defence Research Stack
Address the three mechanistic axes of mucosal defence — anti-inflammatory cytokine suppression, antimicrobial peptide activity, and tight-junction barrier integrity — in pre-clinical gut-immunity models.
Immune Research Stack — Thymic Peptide Framework
Combine mechanistically distinct immune-modulator research peptides — thymic-lineage T-cell maturation (thymosin alpha-1), zinc-dependent thymic immune modulation (thymulin), antimicrobial host-defence (LL-37), and NF-κB-suppression anti-inflammatory (KPV) — to explore multi-mechanism immune pharmacology in pre-clinical research models.
Side-by-side comparisons
Cited in research summaries
Best healing peptides for research in 2026
This is a 2026 reference list of the most actively studied research peptides for tissue healing, repair, and regeneration. It is organised by evidence-base depth — not by commercial popularity, supplier prominence, or social-media visibility — and applies to laboratory research selection. BPC-157 remains the most-studied research peptide for soft-tissue repair; GHK-Cu leads dermal regeneration; KPV and larazotide dominate gut-barrier research; LL-37 sits at the antimicrobial-host-defence intersection. The peptides included on this list all have indexed peer-reviewed publications, plausible mechanism of action, and at least some independent replication outside the discovering laboratory. Compounds whose evidence is confined to a single laboratory or supplier marketing material are not included.
UK research peptide regulation in 2026 — a reference guide
The UK regulatory position on research peptides sits across four distinct frameworks — MHRA medicines licensing, WADA anti-doping classifications, the Misuse of Drugs Act, and the Human Medicines Regulations 2012. This reference explains how each applies, and what the research-versus-supply distinction means in practice.
Related peptides
KPV
A three-amino-acid C-terminal fragment of α-MSH studied for its anti-inflammatory effects in colitis, atopic skin conditions, and mucosal healing models — without the pigmentary effects of full-length MSH.
GHK-Cu
A naturally occurring copper-binding tripeptide (Gly-His-Lys) complexed with Cu(II). Extensively studied in dermatology for wound healing, collagen synthesis, antioxidant defence, and hair-follicle stimulation.
BPC-157
A 15-amino-acid pentadecapeptide derived from a protective protein found in human gastric juice. The most-studied healing research peptide, with extensive pre-clinical work on tendon, ligament, gut, and vascular repair.