Antimicrobial research peptides
Antimicrobial peptide research focuses on cationic amphipathic peptides that disrupt anionic microbial membranes while modulating host immune signalling. LL-37 is the principal mammalian example.
Antimicrobial peptides (AMPs) represent one of the most ancient arms of innate immunity, found across invertebrates, plants, and vertebrates as first-line defenders against microbial colonisation. The defining structural feature of AMPs relevant to this research category is cationicity combined with amphipathicity: a net positive charge (arising from lysine and arginine residues) that enables electrostatic docking to the anionic surface of microbial membranes, and an amphipathic secondary structure that facilitates membrane insertion and destabilisation. Mammalian cell membranes, being predominantly zwitterionic (phosphatidylcholine, sphingomyelin) rather than anionic, are substantially less susceptible to this mechanism, providing a degree of selectivity that has driven research interest in AMPs as alternatives or adjuncts to conventional antibiotics — particularly in the context of drug-resistant organisms. LL-37 is the sole human cathelicidin and the only compound currently catalogued in this category on this site. Its antimicrobial mechanism is well-characterised: the 37-residue peptide [LL-37, 37 aa] adopts a predominantly disordered conformation in aqueous solution but forms a stable amphipathic alpha-helix upon contact with anionic lipid membranes or at physiological salt concentrations at wound surfaces. In this helical state, electrostatic attraction positions positively charged residues against phosphatidylglycerol headgroups and lipopolysaccharide (in Gram-negative organisms), enabling membrane insertion via carpet-mechanism solubilisation or toroidal-pore formation, leading to rapid loss of membrane integrity and bacterial death. Minimum inhibitory concentrations against clinical MRSA isolates range from 2–8 µg/mL and against Pseudomonas aeruginosa from 4–16 µg/mL in standard broth microdilution assays (Overhage et al., Antimicrob Agents Chemother, 2010), with enhanced activity in biofilm-disruption paradigms compared with many conventional antibiotics. Beyond direct killing, LL-37 functions as a host-defence signalling molecule, which is what distinguishes this research field from simple antibiotic development. LL-37 is a ligand for formyl peptide receptor 2 (FPR2/ALX) on neutrophils, monocytes, and macrophages, triggering chemotaxis and cytokine release. It transactivates EGFR on keratinocytes through ADAM-10/17-mediated shedding of HB-EGF, driving re-epithelialisation. In endothelial cells, FPR2 engagement promotes tube formation and angiogenesis. Critically, in pathological contexts, LL-37 forms complexes with extracellular self-DNA and self-RNA in psoriatic skin lesions, enabling these complexes to be taken up by plasmacytoid dendritic cells and to activate TLR7/9-dependent IFN-α production — directly initiating the autoinflammatory psoriatic loop (Lande et al., Nature, 2007). This dual-edged biology — essential defence effector at physiological concentrations, potential autoinflammatory driver when overexpressed — is a defining feature of LL-37 research. Pre-clinical assays in the antimicrobial peptide field are methodologically distinct from healing-peptide assays. Minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) determination by standard CLSI broth microdilution is the primary quantitative readout for direct killing. Biofilm susceptibility is assessed in static 96-well and microfluidic flow-cell formats, with viable-cell counting and confocal/scanning electron microscopy for structural characterisation. Time-kill kinetics and membrane-permeabilisation assays (propidium iodide uptake, DiOC2 membrane-potential dyes) provide mechanistic confirmation. Murine skin-infection and mucosal models complement in vitro data. LL-37 is not listed on the current WADA Prohibited List and is not MHRA-authorised as a medicine, though it is not a controlled substance under UK law. Possession for bona fide in-vitro laboratory research is unrestricted. A critical practical consideration for any LL-37 research is peptide adsorption: LL-37's high cationicity results in substantial binding to standard polystyrene and polypropylene labware, meaning effective concentrations in assay systems can differ markedly from nominal concentrations; low-binding vessels and carrier-protein supplementation are recommended in published protocols. Open research questions include identifying structural analogues that retain broad-spectrum antimicrobial potency while attenuating the autoinflammatory signalling functions, characterising the in vivo relationship between LL-37 and the microbiome in mucosal surfaces, and understanding the extent to which vitamin D-driven CAMP gene upregulation influences LL-37-mediated innate defence against respiratory pathogens.
Peptides in this category
Relevant research stacks
Relevant comparisons
Where to source research peptides for laboratory research
The following UK-based suppliers stock research-grade, lyophilised peptides for in-vitro and pre-clinical work. Purity and provenance vary; always request a Certificate of Analysis (CoA) and confirm cold-chain storage on arrival. None of the products linked below are approved for human use.
- PeptideAuthority.co.uk
UK-based research peptide supplier with batch certificates of analysis and >99% purity testing.
- PeptideBarn.co.uk
Wide catalogue of research-grade lyophilised peptides shipped from the UK, including bulk vials.